Skip to main content

Table 1 Partial matches of sample peptides to sequences in the database of bioactive peptides

From: ACE inhibitory peptides in standard and fermented deer velvet: an in silico and in vitro investigation

SamplePeptideMatched NameActivityMatched Bioactive Sequence*
FDVAVVYPWTQRLVV-hemorphin-6Opioid/ACE inhibitorLVVYPWTQR
 FLSFPTTKBovine haemoglobin peptideAntimicrobialFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 FLSFPTTKTYFPHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 SFPTTKFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 SFPTTKTYFPHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 SFPTTKTYFPHFDLSHGSAQFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 SFPTTKTYFPHFDLSHGSAQVKFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHGFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHGSFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHGSAFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHGSAQFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHGSAQVKFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 SRAGLQFPVGRVHBuforin IIAntimicrobialTRSSRAGLQFPVGRVHRLLRK
 QVSLNSGYACE inhibitorACE inhibitorQVSLNSGYY
 AAWGKVGGNAPAFWound healing peptideWound healing/ immunomodulatoryVLSAADKSNVKAAWGKVGGNAPAFGAEALLRM
 AAWGKVGGNAPAFGAEVLSAADKSNVKAAWGKVGGNAPAFGAEALLRM
DVASFPTTKTYFPHFDLSHGBovine haemoglobin peptideAntimicrobialFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 PTTKTYFPHFDLSHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 PTTKTYFPHFDLSHGFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TKTYFPHFDLSHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TKTYFPHFDLSHGFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 TYFPHFDLSHGFLSFPTTKTYFPHFDLSHGSAQVKGHGAK
 VLSAADKSNVKWound healing peptideWound healing/ immunomodulatoryVLSAADKSNVKAAWGKVGGNAPAFGAEALLRM
  1. *The portions of the bioactive sequences that were matched by the peptides in FDVA and DVA are shown in bold